Name :
IL21R (Human) Recombinant Protein
Biological Activity :
Human IL21R (Q9HBE5, 20 a.a. – 232 a.a.) partial recombinant protein with His tag at C-terminus expressed in HEK293 cells.Bioactive Protein,Bioactive Proteins,Bioactive,Active,Functional Protein,Functional Proteins,Recombinant Human Protein,Recombinant Human Proteins,Human Recombinant Protein,Human Recombinant Proteins,HuPro
Tag :
Result of bioactivity analysis
Protein Accession No. :
Q9HBE5
Protein Accession No.URL :
https://www.ncbi.nlm.nih.gov/gene?cmd=Retrieve&dopt=Graphics&list_uids=50615
Amino Acid Sequence :
CPDLVCYTDYLQTVICILEMWNLHPSTLTLTWQDQYEELKDEATSCSLHRSAHNATHATYTCHMDVFHFMADDIFSVNITDQSGNYSQECGSFLLAESIKPAPPFNVTVTFSGQYNISWRSDYEDPAFYMLKGKLQYELQYRNRGDPWAVSPRRKLISVDSRSVSLLPLEFRKDSSYELQVRAGPMPGSSYQGTWSEWSDPVIFQTQSEELKE
Molecular Weight :
25.65
Storage and Stability :
Store at 2°C to 8°C for 1 week. For long term storage, aliquot and store at -20°C to -80°C.Aliquot to avoid repeated freezing and thawing.
Host :
Human
Interspecies Antigen Sequence :
Preparation Method :
Mammalian cell (Expi293, high-yield transient HEK293) expression system
Purification :
Quality Control Testing :
SEC-HPLC and Tris-Bis PAGE SEC-HPLC Human IL-21R on Tris-Bis PAGE under reduced condition. The purity is greater than 95%. Tris-Bis PAGE Human IL-21R on Tris-Bis PAGE under reduced condition. The purity is greater than 95%.
Storage Buffer :
Lyophilized from sterile distilled Water is > 100 ug/mL
Applications :
Enzyme-linked Immunoabsorbent Assay， Immobilized Human IL-21 at 1 ug/mL(100 uL/well) on the plate. Dose response curve for Human IL-21R, His Tag with the EC50 of 24.3 ng/mL determined by ELISA. Functional Study， SDS-PAGE，
Gene Name :
IL21R
Gene Alias :
MGC10967, NILR
Gene Description :
interleukin 21 receptor
Gene Summary :
The protein encoded by this gene is a cytokine receptor for interleukin 21 (IL21). It belongs to the type I cytokine receptors, and has been shown to form a heterodimeric receptor complex with the common gamma-chain, a receptor subunit also shared by the receptors for interleukin 2, 4, 7, 9, and 15. This receptor transduces the growth promoting signal of IL21, and is important for the proliferation and differentiation of T cells, B cells, and natural killer (NK) cells. The ligand binding of this receptor leads to the activation of multiple downstream signaling molecules, including JAK1, JAK3, STAT1, and STAT3. Knockout studies of a similar gene in mouse suggest a role for this gene in regulating immunoglobulin production. Three alternatively spliced transcript variants encoding the same protein have been described. [provided by RefSeq
Other Designations :
–
MedChemExpress (MCE) recombinant proteins include: cytokines, enzymes, growth factors, hormones, receptors, transcription factors, antibody fragments, etc. They are often essential for supporting cell growth, stimulating cell signaling pathways, triggering or inhibiting cell differentiation; and are useful tools for elucidating protein structure and function, understanding disease onset and progression, and validating pharmaceutical targets. At MedChemExpress (MCE), we strive to provide products with only the highest quality. Protein identity, purity and biological activity are assured by our robust quality control and assurance procedures.
Related category websites: https://www.medchemexpress.com/recombinant-proteins.html
Popular product recommendations:
MCP-1/CCL2 ProteinAccession
IL-17 Receptor Recombinant Proteins
Popular categories:
VEGFR-3
VEGF-A