Name :
SELE (Human) Recombinant Protein

Biological Activity :
Human SELE (P16581, 22 a.a. – 556 a.a.) partial length recombinant protein His tag expressed in Baculovirus expression system.Bioactive Protein,Bioactive Proteins,Bioactive,Active,Functional Protein,Functional Proteins

Tag :

Protein Accession No. :
P16581

Protein Accession No.URL :
https://www.ncbi.nlm.nih.gov/gene?cmd=Retrieve&dopt=Graphics&list_uids=6401

Amino Acid Sequence :
WSYNTSTEAMTYDEASAYCQQRYTHLVAIQNKEEIEYLNSILSYSPSYYWIGIRKVNNVWVWVGTQKPLTEEAKNWAPGEPNNRQKDEDCVEIYIKREKDVGMWNDERCSKKKLALCYTAACTNTSCSGHGECVETINNYTCKCDPGFSGLKCEQIVNCTALESPEHGSLVCSHPLGNFSYNSSCSISCDRGYLPSSMETMQCMSSGEWSAPIPACNVVECDAVTNPANGFVECFQNPGSFPWNTTCTFDCEEGFELMGAQSLQCTSSGNWDNEKPTCKAVTCRAVRQPQNGSVRCSHSPAGEFTFKSSCNFTCEEGFMLQGPAQVECTTQGQWTQQIPVCEAFQCTALSNPERGYMNCLPSASGSFRYGSSCEFSCEQGFVLKGSKRLQCGPTGEWDNEKPTCEAVRCDAVHQPPKGLVRCAHSPIGEFTYKSSCAFSCEEGFELHGSTQLECTSQGQWTEEVPSCQVVKCSSLAVPGKINMSCSGEPVFGTVCKFACPEGWTLNGSAARTCGATGHWSGLLPTCEAPTESNIP

Molecular Weight :
59.4

Storage and Stability :
Store at 2°C to 8°C for 1 week. For long term storage, aliquot and store at -20°C to -80°C.Aliquot to avoid repeated freezing and thawing.

Host :
Viruses

Interspecies Antigen Sequence :

Preparation Method :
Baculovirus expression system

Purification :

Quality Control Testing :
3 ug by SDS-PAGE under reducing condition and visualized by Coomassie blue stain.

Storage Buffer :
In Phosphate-Buffer Saline pH 7.4 (10% glycerol)

Applications :
Functional Study, SDS-PAGE,

Gene Name :
SELE

Gene Alias :
CD62E, ELAM, ELAM1, ESEL, LECAM2

Gene Description :
selectin E

Gene Summary :
The protein encoded by this gene is found in cytokine-stimulated endothelial cells and is thought to be responsible for the accumulation of blood leukocytes at sites of inflammation by mediating the adhesion of cells to the vascular lining. It exhibits structural features such as the presence of lectin- and EGF-like domains followed by short consensus repeat (SCR) domains that contain 6 conserved cysteine residues. These proteins are part of the selectin family of cell adhesion molecules. Adhesion molecules participate in the interaction between leukocytes and the endothelium and appear to be involved in the pathogenesis of atherosclerosis. [provided by RefSeq

Other Designations :
OTTHUMP00000032745|endothelial adhesion molecule 1|leukocyte endothelial cell adhesion molecule 2

MedChemExpress (MCE) recombinant proteins include: cytokines, enzymes, growth factors, hormones, receptors, transcription factors, antibody fragments, etc. They are often essential for supporting cell growth, stimulating cell signaling pathways, triggering or inhibiting cell differentiation; and are useful tools for elucidating protein structure and function, understanding disease onset and progression, and validating pharmaceutical targets. At MedChemExpress (MCE), we strive to provide products with only the highest quality. Protein identity, purity and biological activity are assured by our robust quality control and assurance procedures.
Related category websites: https://www.medchemexpress.com/recombinant-proteins.html
Popular product recommendations:
IGF-I/IGF-1 ProteinMedChemExpress
SARS-CoV-2 RNA Dependent RNA Polymerase web
Popular categories:
CD49f/Integrin alpha-6
ALK-6