Name :
SULT1A2 (Human) Recombinant Protein
Biological Activity :
Human SULT1A2 (NP_001045, 1 a.a. – 295 a.a.) full-length recombinant protein with His tag expressed in Escherichia coli.Full-Length Protein,Full-Length Proteins,Full-Length,Full Length,FullLength
Tag :
Protein Accession No. :
NP_001045
Protein Accession No.URL :
https://www.ncbi.nlm.nih.gov/gene?cmd=Retrieve&dopt=Graphics&list_uids=6799
Amino Acid Sequence :
MGSSHHHHHHSSGLVPRGSHMELIQDISRPPLEYVKGVPLIKYFAEALGPLQSFQARPDDLLISTYPKSGTTWVSQILDMIYQGGDLEKCHRAPIFMRVPFLEFKVPGIPSGMETLKNTPAPRLLKTHLPLALLPQTLLDQKVKVVYVARNAKDVAVSYYHFYHMAKVYPHPGTWESFLEKFMAGEVSYGSWYQHVQEWWELSRTHPVLYLFYEDMKENPKREIQKILEFVGRSLPEETVDLMVEHTSFKEMKKNPMTNYTTVRREFMDHSISPFMRKGMAGDWKTTFTVAQNERFDADYAEKMAGCSLSFRSEL
Molecular Weight :
36.4
Storage and Stability :
Store at 2°C to 8°C for 1 week. For long term storage, aliquot and store at -20°C to -80°C.Aliquot to avoid repeated freezing and thawing.
Host :
Escherichia coli
Interspecies Antigen Sequence :
Preparation Method :
Escherichia coli expression system
Purification :
Conventional Chromatography
Quality Control Testing :
Storage Buffer :
In 20 mM Tris-HCl buffer, 0.1 M NaCl, pH 8.0 (1 mM DTT, 10% glycerol).
Applications :
SDS-PAGE，
Gene Name :
SULT1A2
Gene Alias :
HAST4, MGC142287, MGC142289, P-PST, ST1A2, STP2, TSPST2
Gene Description :
sulfotransferase family, cytosolic, 1A, phenol-preferring, member 2
Gene Summary :
Sulfotransferase enzymes catalyze the sulfate conjugation of many hormones, neurotransmitters, drugs, and xenobiotic compounds. These cytosolic enzymes are different in their tissue distributions and substrate specificities. The gene structure (number and length of exons) is similar among family members. This gene encodes one of two phenol sulfotransferases with thermostable enzyme activity. Two alternatively spliced variants that encode the same protein have been described. [provided by RefSeq
Other Designations :
aryl sulfotransferase|arylamine sulfotransferase|phenol-preferring phenol sulfotransferase2|phenol-sulfating phenol sulfotransferase 2|phenolic-metabolizing (P) form of PST|thermostable phenol sulfotransferase
MedChemExpress (MCE) recombinant proteins include: cytokines, enzymes, growth factors, hormones, receptors, transcription factors, antibody fragments, etc. They are often essential for supporting cell growth, stimulating cell signaling pathways, triggering or inhibiting cell differentiation; and are useful tools for elucidating protein structure and function, understanding disease onset and progression, and validating pharmaceutical targets. At MedChemExpress (MCE), we strive to provide products with only the highest quality. Protein identity, purity and biological activity are assured by our robust quality control and assurance procedures.
Related category websites: https://www.medchemexpress.com/recombinant-proteins.html
Popular product recommendations:
IL-6 web
CDNF ProteinSpecies
Popular categories:
IL-27 beta/EBI3
AMPK