Name :
NCR3 (Human) Recombinant Protein (P01)
Biological Activity :
Human NCR3 full-length ORF ( NP_667341.1, 1 a.a. – 201 a.a.) recombinant protein with GST-tag at N-terminal.Full-Length Protein,Full-Length Proteins,Full-Length,Full Length,FullLength
Tag :
Best use within three months from the date of receipt of this protein.
Protein Accession No. :
NP_667341.1
Protein Accession No.URL :
https://www.ncbi.nlm.nih.gov/gene?cmd=Retrieve&dopt=Graphics&list_uids=259197
Amino Acid Sequence :
MAWMLLLILIMVHPGSCALWVSQPPEIRTLEGSSAFLPCSFNASQGRLAIGSVTWFRDEVVPGKEVRNGTPEFRGRLAPLASSRFLHDHQAELHIRDVRGHDASIYVCRVEVLGLGVGTGNGTRLVVEKEHPQLGAGTVLLLRAGFYAVSFLSVAVGSTVYYQGKCLTWKGPRRQLPAVVPAPLPPPCGSSAHLLPPVPGG
Molecular Weight :
48
Storage and Stability :
Store at -80°C. Aliquot to avoid repeated freezing and thawing.
Host :
Wheat Germ (in vitro)
Interspecies Antigen Sequence :
Preparation Method :
in vitro wheat germ expression system
Purification :
Glutathione Sepharose 4 Fast Flow
Quality Control Testing :
12.5% SDS-PAGE Stained with Coomassie Blue.
Storage Buffer :
50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Applications :
Enzyme-linked Immunoabsorbent Assay， Western Blot (Recombinant protein)， Antibody Production， Protein Array，
Gene Name :
NCR3
Gene Alias :
1C7, CD337, LY117, MALS, NKp30
Gene Description :
natural cytotoxicity triggering receptor 3
Gene Summary :
Natural cytotoxicity receptors (NCRs), such as NCR3, are activating natural killer (NK) cell receptors that belong to the immunoglobulin (Ig) superfamily. NCR3 is expressed in all resting and activated NK cells and forms a complex with CD3-zeta (CD3Z, or CD247; MIM 186780) (Sato et al., 2001 [PubMed 11782277]).[supplied by OMIM
Other Designations :
OTTHUMP00000029162|OTTHUMP00000038859|OTTHUMP00000038863|lymphocyte antigen 117
MedChemExpress (MCE) recombinant proteins include: cytokines, enzymes, growth factors, hormones, receptors, transcription factors, antibody fragments, etc. They are often essential for supporting cell growth, stimulating cell signaling pathways, triggering or inhibiting cell differentiation; and are useful tools for elucidating protein structure and function, understanding disease onset and progression, and validating pharmaceutical targets. At MedChemExpress (MCE), we strive to provide products with only the highest quality. Protein identity, purity and biological activity are assured by our robust quality control and assurance procedures.
Related category websites: https://www.medchemexpress.com/recombinant-proteins.html
Popular product recommendations:
GM-CSF Recombinant Proteins
CFHR1 Proteincustom synthesis
Popular categories:
Mineralocorticoid Receptor
Signal Transduction-related CD Proteins